FXYD5 antibody (N-Term)

Catalog No. ABIN630255

Product Details anti-FXYD5 Antibody

Target: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FXYD5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FXYD5 antibody was raised against the N terminal of FXYD5

Purification: Purified

Immunogen: FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD

Application Details

Application Notes: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FXYD5 Blocking Peptide, catalog no. 33R-5326, is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FXYD5

Target: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Alternative Name: FXYD5 (FXYD5 Products)

Synonyms: FXYD5 antibody, DYSAD antibody, IWU1 antibody, KCT1 antibody, OIT2 antibody, PRO6241 antibody, RIC antibody, EF-8 antibody, Oit2 antibody, FXYD domain containing ion transport regulator 5 antibody, FXYD domain-containing ion transport regulator 5 antibody, FXYD5 antibody, Fxyd5 antibody

Background: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.

Molecular Weight: 20 kDa (MW of target protein)