GJE1 antibody (C-Term)

Catalog No. ABIN630271

This Rabbit Polyclonal antibody specifically detects GJE1 in WB. It exhibits reactivity toward Human.

Quick Overview for GJE1 antibody (C-Term) (ABIN630271)

Target: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GJE1 Antibody

Binding Specificity: C-Term

Specificity: GJE1 antibody was raised against the C terminal of GJE1

Purification: Purified

Immunogen: GJE1 antibody was raised using the C terminal of GJE1 corresponding to a region with amino acids KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJE1 Blocking Peptide, (ABIN940125), is also available for use as a blocking control in assays to test for specificity of this GJE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJE1

Target: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Alternative Name: GJE1

Background: GJE1 is a protein component of GAP junction

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Sensory Perception of Sound