Annexin a1 antibody (N-Term)

Catalog No. ABIN630276

This anti-Annexin a1 antibody is a Rabbit Polyclonal antibody detecting Annexin a1 in WB and IHC. Suitable for Chemical.

Quick Overview for Annexin a1 antibody (N-Term) (ABIN630276)

Target: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin a1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Annexin a1 Antibody

Binding Specificity: N-Term

Specificity: Annexin A1 antibody was raised against the N terminal of ANXA1

Cross-Reactivity: Human

Purification: Purified

Immunogen: Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A1 Blocking Peptide, (ABIN5612075), is also available for use as a blocking control in assays to test for specificity of this Annexin A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin a1

Target: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Alternative Name: Annexin A1

Target Type: Chemical

Background: ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Hormone Transport