Annexin a1 antibody (N-Term)
-
- Target See all Annexin a1 (ANXA1) Antibodies
- Annexin a1 (ANXA1) (Annexin A1 (ANXA1))
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin a1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Annexin A1 antibody was raised against the N terminal of ANXA1
- Cross-Reactivity
- Human
- Purification
- Purified
- Immunogen
- Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
- Top Product
- Discover our top product ANXA1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A1 Blocking Peptide, catalog no. 33R-9944, is also available for use as a blocking control in assays to test for specificity of this Annexin A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin a1 (ANXA1) (Annexin A1 (ANXA1))
- Alternative Name
- Annexin A1 (ANXA1 Products)
- Target Type
- Chemical
- Background
- ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
- Molecular Weight
- 38 kDa (MW of target protein)
- Pathways
- Hormone Transport
-