PTK2B antibody (C-Term)

Catalog No. ABIN630279

This anti-PTK2B antibody is a Rabbit Polyclonal antibody detecting PTK2B in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for PTK2B antibody (C-Term) (ABIN630279)

Target: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTK2B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PTK2B Antibody

Binding Specificity: C-Term

Specificity: PTK2 B antibody was raised against the C terminal of PTK2

Purification: Purified

Immunogen: PTK2 B antibody was raised using the C terminal of PTK2 corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTK2B Blocking Peptide, (ABIN5615657), is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTK2B

Target: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Alternative Name: PTK2B

Background: PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.

Molecular Weight: 116 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Cellular Glucan Metabolic Process, Cell-Cell Junction Organization, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Positive Regulation of fat Cell Differentiation, VEGF Signaling