NOV antibody (C-Term)

Catalog No. ABIN630288

Product Details anti-NOV Antibody

Target: NOV (Nephroblastoma Overexpressed (NOV))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOV antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NOV antibody was raised against the C terminal of NOV

Purification: Purified

Immunogen: NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOV Blocking Peptide, catalog no. 33R-4680, is also available for use as a blocking control in assays to test for specificity of this NOV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOV

Target: NOV (Nephroblastoma Overexpressed (NOV))

Alternative Name: NOV (NOV Products)

Synonyms: CCN3 antibody, IBP-9 antibody, IGFBP-9 antibody, IGFBP9 antibody, NOVh antibody, nov-A antibody, xnov antibody, NovH antibody, C130088N23Rik antibody, nephroblastoma overexpressed antibody, nephroblastoma overexpressed L homeolog antibody, nephroblastoma overexpressed gene antibody, NOV antibody, nov.L antibody, Nov antibody

Background: As an immediate-early protein, NOV is likely to play a role in cell growth regulation.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Growth Factor Binding