SLC41A2 antibody (N-Term)

Catalog No. ABIN630335

Product Details anti-SLC41A2 Antibody

Target: SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC41A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC41 A2 antibody was raised against the N terminal of SLC41 2

Purification: Purified

Immunogen: SLC41 A2 antibody was raised using the N terminal of SLC41 2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC41A2 Blocking Peptide, catalog no. 33R-8340, is also available for use as a blocking control in assays to test for specificity of this SLC41A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC41A2

Target: SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))

Alternative Name: SLC41A2 (SLC41A2 Products)

Synonyms: MGC83802 antibody, slc41a1-l1 antibody, SLC41A1-L1 antibody, A230035L05Rik antibody, solute carrier family 41 member 2 antibody, solute carrier family 41 member 2 L homeolog antibody, solute carrier family 41, member 2 antibody, Slc41a2 antibody, slc41a2.L antibody, SLC41A2 antibody, slc41a2 antibody

Background: SLC41A2 acts as a plasma-membrane magnesium transporter.

Molecular Weight: 53 kDa (MW of target protein)