S1PR5 antibody (N-Term)

Catalog No. ABIN630339

This anti-S1PR5 antibody is a Rabbit Polyclonal antibody detecting S1PR5 in WB and IHC. Suitable for Human, Mouse, Rat, Dog, Drosophila melanogaster and Zebrafish (Danio rerio).

Quick Overview for S1PR5 antibody (N-Term) (ABIN630339)

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S1PR5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-S1PR5 Antibody

Binding Specificity: N-Term

Specificity: EDG8 antibody was raised against the N terminal of EDG8

Purification: Purified

Immunogen: EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EDG8 Blocking Peptide, (ABIN5613303), is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S1PR5

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Alternative Name: EDG8

Background: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

Molecular Weight: 16 kDa (MW of target protein)