UBE2J1 antibody

Catalog No. ABIN630349

Product Details anti-UBE2J1 Antibody

Target: UBE2J1 (Ubiquitin-Conjugating Enzyme E2, J1, U (UBE2J1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2J1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: UBE2 J1 antibody was raised using a synthetic peptide corresponding to a region with amino acids METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2J1 Blocking Peptide, catalog no. 33R-5976, is also available for use as a blocking control in assays to test for specificity of this UBE2J1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2J1

Target: UBE2J1 (Ubiquitin-Conjugating Enzyme E2, J1, U (UBE2J1))

Alternative Name: UBE2J1 (UBE2J1 Products)

Synonyms: NCUBE1 antibody, ubc6p antibody, cgi-76 antibody, ncube1 antibody, hspc153 antibody, hspc205 antibody, hsu93243 antibody, HSPC153 antibody, HSPC205 antibody, HSU93243 antibody, NCUBE-1 antibody, UBC6 antibody, Ubc6p antibody, zgc:63554 antibody, UB2J1 antibody, 0710008M05Rik antibody, 1110030I22Rik antibody, Ncube antibody, Ncube1 antibody, ubiquitin conjugating enzyme E2 J1 antibody, ubiquitin-conjugating enzyme E2 J1 antibody, ubiquitin-conjugating enzyme E2, J1 antibody, ubiquitin conjugating enzyme E2 J1 L homeolog antibody, ubiquitin-conjugating enzyme E2J 1 antibody, UBE2J1 antibody, EDI_253240 antibody, MCYG_03847 antibody, ube2j1 antibody, ube2j1.L antibody, Ube2j1 antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.

Molecular Weight: 35 kDa (MW of target protein)