TRIM59 antibody (Middle Region)

Catalog No. ABIN630352

This Rabbit Polyclonal antibody specifically detects TRIM59 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for TRIM59 antibody (Middle Region) (ABIN630352)

Target: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM59 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TRIM59 Antibody

Binding Specificity: Middle Region

Specificity: TRIM59 antibody was raised against the middle region of TRIM59

Purification: Purified

Immunogen: TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM59 Blocking Peptide, (ABIN940298), is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM59

Target: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Alternative Name: TRIM59

Background: The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome