SLC26A5 antibody

Catalog No. ABIN630355

This Rabbit Polyclonal antibody specifically detects SLC26A5 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for SLC26A5 antibody (ABIN630355)

Target: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC26A5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC26A5 Antibody

Purification: Purified

Immunogen: SLC26 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC26A5 Blocking Peptide, (ABIN938469), is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC26A5

Target: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Alternative Name: SLC26A5

Background: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Dicarboxylic Acid Transport