ELOVL7 antibody

Catalog No. ABIN630361

Product Details anti-ELOVL7 Antibody

Target: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELOVL7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELOVL7 Blocking Peptide, catalog no. 33R-5651, is also available for use as a blocking control in assays to test for specificity of this ELOVL7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELOVL7

Target: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Alternative Name: ELOVL7 (ELOVL7 Products)

Synonyms: 9130013K24Rik antibody, AI840082 antibody, elovl1 antibody, wu:fd20a06 antibody, zgc:56422 antibody, cgpr01 antibody, elovl7 antibody, fi36f02 antibody, wu:fi36f02 antibody, zgc:55879 antibody, ELOVL fatty acid elongase 7 antibody, Elongation of very long chain fatty acids protein 7 antibody, elongation of very long chain fatty acids protein 7 antibody, ELOVL family member 7, elongation of long chain fatty acids (yeast) antibody, ELOVL fatty acid elongase 7b antibody, ELOVL fatty acid elongase 7 L homeolog antibody, ELOVL fatty acid elongase 7a antibody, ELOVL7 antibody, elov7 antibody, Elovl7 antibody, elovl7b antibody, elovl7.L antibody, elovl7a antibody

Background: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

Molecular Weight: 33 kDa (MW of target protein)