ELOVL7 antibody

Catalog No. ABIN630361

This Rabbit Polyclonal antibody specifically detects ELOVL7 in WB. It exhibits reactivity toward Human.

Quick Overview for ELOVL7 antibody (ABIN630361)

Target: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELOVL7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ELOVL7 Antibody

Purification: Purified

Immunogen: ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELOVL7 Blocking Peptide, (ABIN5613362), is also available for use as a blocking control in assays to test for specificity of this ELOVL7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELOVL7

Target: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Alternative Name: ELOVL7

Background: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

Molecular Weight: 33 kDa (MW of target protein)