CLCC1 antibody (N-Term)

Catalog No. ABIN630362

The Rabbit Polyclonal anti-CLCC1 antibody has been validated for WB and IHC. It is suitable to detect CLCC1 in samples from Human, Rat, Mouse and Dog.

Quick Overview for CLCC1 antibody (N-Term) (ABIN630362)

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CLCC1 Antibody

Binding Specificity: N-Term

Specificity: CLCC1 antibody was raised against the N terminal of CLCC1

Purification: Purified

Immunogen: CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLCC1 Blocking Peptide, (ABIN5612913), is also available for use as a blocking control in assays to test for specificity of this CLCC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLCC1

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Alternative Name: CLCC1

Background: CLCC1 seems to act as a chloride ion channel.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection