MCT3 antibody

Catalog No. ABIN630366

Cited in 1 publication. The Rabbit Polyclonal anti-MCT3 antibody (ABIN630366) specifically detects MCT3 in WB and IHC. The antibody is reactive with Human samples.

Quick Overview for MCT3 antibody (ABIN630366)

Target: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCT3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MCT3 Antibody

Purification: Purified

Immunogen: SLC16 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC16A8 Blocking Peptide, (ABIN5616184), is also available for use as a blocking control in assays to test for specificity of this SLC16A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-MCT3 antibody (ABIN630366)

Tian, Xiao, Su, Li, Peng, Meng: "Impact of SLC16A8 on tumor microenvironment and angiogenesis in colorectal cancer: New therapeutic target insights." in: World journal of gastrointestinal oncology, Vol. 17, Issue 4, pp. 99188, (2025) (PubMed).

Target Details for MCT3

Target: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Alternative Name: SLC16A8

Background: SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Molecular Weight: 55 kDa (MW of target protein)