SLC35F2 antibody (N-Term)

Catalog No. ABIN630368

Product Details anti-SLC35F2 Antibody

Target: SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35F2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SLC35 F2 antibody was raised against the N terminal of SLC35 2

Purification: Purified

Immunogen: SLC35 F2 antibody was raised using the N terminal of SLC35 2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35F2 Blocking Peptide, catalog no. 33R-5885, is also available for use as a blocking control in assays to test for specificity of this SLC35F2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35F2

Target: SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))

Alternative Name: SLC35F2 (SLC35F2 Products)

Synonyms: HSNOV1 antibody, 1500009K05Rik antibody, AU019213 antibody, solute carrier family 35 member F2 antibody, solute carrier family 35, member F2 antibody, SLC35F2 antibody, Slc35f2 antibody

Background: SLC35F2 is a putative solute transporter.

Molecular Weight: 41 kDa (MW of target protein)