SLC19A1 antibody

Catalog No. ABIN630376

Product Details anti-SLC19A1 Antibody

Target: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC19A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC19A1 Blocking Peptide, catalog no. 33R-6599, is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC19A1

Target: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Alternative Name: SLC19A1 (SLC19A1 Products)

Synonyms: A1 antibody, MHCBFB antibody, PO-GA antibody, RECC1 antibody, RFC antibody, RFC140 antibody, CHMD antibody, FOLT antibody, IFC1 antibody, REFC antibody, RFC1 antibody, LOC100226745 antibody, AI323572 antibody, RFC-1 antibody, MTX1 antibody, XRFC antibody, chmd antibody, folt antibody, ifc1 antibody, refc antibody, rfc1 antibody, slc19a1 antibody, replication factor C subunit 1 antibody, solute carrier family 19 member 1 antibody, folate transporter 1 antibody, solute carrier family 19 (folate transporter), member 1 antibody, solute carrier family 19 (folate transporter), member 1 L homeolog antibody, RFC1 antibody, SLC19A1 antibody, LOC100226745 antibody, Slc19a1 antibody, slc19a1.L antibody

Background: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport