CRELD1 antibody (C-Term)

Catalog No. ABIN630381

Product Details anti-CRELD1 Antibody

Target: CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRELD1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: CRELD1 antibody was raised against the C terminal of CRELD1

Purification: Purified

Immunogen: CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRELD1 Blocking Peptide, catalog no. 33R-9056, is also available for use as a blocking control in assays to test for specificity of this CRELD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRELD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRELD1

Target: CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))

Alternative Name: CRELD1 (CRELD1 Products)

Synonyms: AVSD2 antibody, CIRRIN antibody, AI843811 antibody, cysteine rich with EGF like domains 1 antibody, cysteine-rich with EGF-like domains 1 antibody, CRELD1 antibody, Creld1 antibody

Background: Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Molecular Weight: 45 kDa (MW of target protein)