SMPD2 antibody

Catalog No. ABIN630382

This Rabbit Polyclonal antibody specifically detects SMPD2 in WB. It exhibits reactivity toward Human.

Quick Overview for SMPD2 antibody (ABIN630382)

Target: SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMPD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SMPD2 Antibody

Purification: Purified

Immunogen: SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMPD2 Blocking Peptide, (ABIN5616305), is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMPD2

Target: SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))

Alternative Name: SMPD2

Background: SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway