SLC13A3 antibody

Catalog No. ABIN630395

The Rabbit Polyclonal anti-SLC13A3 antibody has been validated for WB and IHC. It is suitable to detect SLC13A3 in samples from Human.

Quick Overview for SLC13A3 antibody (ABIN630395)

Target: SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC13A3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC13A3 Antibody

Purification: Purified

Immunogen: SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC13A3 Blocking Peptide, (ABIN938809), is also available for use as a blocking control in assays to test for specificity of this SLC13A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC13A3

Target: SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))

Alternative Name: SLC13A3

Background: Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport