TGFBI antibody (C-Term)

Catalog No. ABIN630399

This anti-TGFBI antibody is a Rabbit Polyclonal antibody detecting TGFBI in WB. Suitable for Human and Mouse.

Quick Overview for TGFBI antibody (C-Term) (ABIN630399)

Target: TGFBI (Transforming Growth Factor, beta-Induced, 68kDa (TGFBI))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGFBI antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TGFBI Antibody

Binding Specificity: C-Term

Specificity: TGFBI antibody was raised against the C terminal of TGFBI

Purification: Purified

Immunogen: TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGFBI Blocking Peptide, (ABIN940480), is also available for use as a blocking control in assays to test for specificity of this TGFBI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFBI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGFBI

Target: TGFBI (Transforming Growth Factor, beta-Induced, 68kDa (TGFBI))

Alternative Name: TGFBI

Background: TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.

Molecular Weight: 46 kDa (MW of target protein)