FADS1 antibody (C-Term)

Catalog No. ABIN630410

Product Details anti-FADS1 Antibody

Target: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FADS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FADS1 antibody was raised against the C terminal of FADS1

Purification: Purified

Immunogen: FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FADS1 Blocking Peptide, catalog no. 33R-3002, is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FADS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FADS1

Target: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Alternative Name: FADS1 (FADS1 Products)

Synonyms: D5D antibody, FADS6 antibody, FADSD5 antibody, LLCDL1 antibody, TU12 antibody, D5FAD antibody, 0710001O03Rik antibody, A930006B21Rik antibody, AI317215 antibody, DSD antibody, fatty acid desaturase 1 antibody, FADS1 antibody, LOC483793 antibody, Fads1 antibody

Background: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha