Aspartate beta Hydroxylase antibody (N-Term)

Catalog No. ABIN630417

This anti-Aspartate beta Hydroxylase antibody is a Rabbit Polyclonal antibody detecting Aspartate beta Hydroxylase in WB and IHC. Suitable for Human.

Quick Overview for Aspartate beta Hydroxylase antibody (N-Term) (ABIN630417)

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aspartate beta Hydroxylase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Aspartate beta Hydroxylase Antibody

Binding Specificity: N-Term

Specificity: ASPH antibody was raised against the N terminal of ASPH

Purification: Purified

Immunogen: ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASPH Blocking Peptide, (ABIN5612192), is also available for use as a blocking control in assays to test for specificity of this ASPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aspartate beta Hydroxylase

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Alternative Name: ASPH

Background: ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity