GPR161 antibody (N-Term)

Catalog No. ABIN630418

This Rabbit Polyclonal antibody specifically detects GPR161 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for GPR161 antibody (N-Term) (ABIN630418)

Target: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR161 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-GPR161 Antibody

Binding Specificity: N-Term

Specificity: GPR161 antibody was raised against the N terminal of GPR161

Purification: Purified

Immunogen: GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR161 Blocking Peptide, (ABIN5613832), is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR161

Target: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Alternative Name: GPR161

Background: GPR161 is orphan receptor.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: cAMP Metabolic Process