SLC29A2 antibody

Catalog No. ABIN630424

Product Details anti-SLC29A2 Antibody

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC29A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC29A2 Blocking Peptide, catalog no. 33R-1475, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC29A2

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Alternative Name: SLC29A2 (SLC29A2 Products)

Synonyms: DER12 antibody, ENT2 antibody, HNP36 antibody, Der12 antibody, Ent2 antibody, Hnp36 antibody, ent2 antibody, der12 antibody, hnp36 antibody, MGC82995 antibody, DKFZp468L038 antibody, zgc:110527 antibody, solute carrier family 29 member 2 antibody, solute carrier family 29 (nucleoside transporters), member 2 antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 2 L homeolog antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 2 antibody, SLC29A2 antibody, Slc29a2 antibody, slc29a2.L antibody, slc29a2 antibody

Background: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Molecular Weight: 50 kDa (MW of target protein)