Tyrosinase-Related Protein 1 antibody (N-Term)

Catalog No. ABIN630432

This anti-Tyrosinase-Related Protein 1 antibody is a Rabbit Polyclonal antibody detecting Tyrosinase-Related Protein 1 in WB. Suitable for Human, Mouse and Dog.

Quick Overview for Tyrosinase-Related Protein 1 antibody (N-Term) (ABIN630432)

Target: Tyrosinase-Related Protein 1 (TYRP1)

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tyrosinase-Related Protein 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Tyrosinase-Related Protein 1 Antibody

Binding Specificity: N-Term

Specificity: TYRP1 antibody was raised against the N terminal of TYRP1

Purification: Purified

Immunogen: TYRP1 antibody was raised using the N terminal of TYRP1 corresponding to a region with amino acids AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TYRP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tyrosinase-Related Protein 1

Target: Tyrosinase-Related Protein 1 (TYRP1)

Alternative Name: TYRP1

Background: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.

Molecular Weight: 59 kDa (MW of target protein)