LCAT antibody (N-Term)

Catalog No. ABIN630433

Product Details anti-LCAT Antibody

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCAT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LCAT antibody was raised against the N terminal of LCAT

Purification: Purified

Immunogen: LCAT antibody was raised using the N terminal of LCAT corresponding to a region with amino acids MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCAT Blocking Peptide, catalog no. 33R-6057, is also available for use as a blocking control in assays to test for specificity of this LCAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCAT

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Alternative Name: LCAT (LCAT Products)

Synonyms: AI046659 antibody, D8Wsu61e antibody, MGC82035 antibody, lcat antibody, MGC88964 antibody, LCAT antibody, lecithin-cholesterol acyltransferase antibody, lecithin cholesterol acyltransferase antibody, lecithin-cholesterol acyltransferase L homeolog antibody, solute carrier family 12 member 4 antibody, fragile site, aphidicolin type, common, fra(13)(q13.2) antibody, LCAT antibody, Lcat antibody, lcat.L antibody, lcat antibody, SLC12A4 antibody, FRA13A antibody

Background: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Lipid Metabolism