LRPAP1 antibody (C-Term)

Catalog No. ABIN630434

Product Details anti-LRPAP1 Antibody

Target: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRPAP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: LRPAP1 antibody was raised against the C terminal of LRPAP1

Purification: Purified

Immunogen: LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRPAP1 Blocking Peptide, catalog no. 33R-3922, is also available for use as a blocking control in assays to test for specificity of this LRPAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRPAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRPAP1

Target: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Alternative Name: LRPAP1 (LRPAP1 Products)

Synonyms: wu:fi20f07 antibody, wu:fi22c06 antibody, LRPAP1 antibody, DKFZp459I2430 antibody, A2MRAP antibody, A2RAP antibody, HBP44 antibody, MRAP antibody, RAP antibody, AA617339 antibody, AI790446 antibody, AU042172 antibody, C77774 antibody, alpha-2-macroglobulin receptor-associated protein-like antibody, low density lipoprotein receptor-related protein associated protein 1 antibody, LDL receptor related protein associated protein 1 antibody, LDL receptor related protein associated protein 1 L homeolog antibody, LOC100231803 antibody, lrpap1 antibody, LRPAP1 antibody, Lrpap1 antibody, lrpap1.L antibody

Background: LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.

Molecular Weight: 39 kDa (MW of target protein)