NEU1 antibody

Catalog No. ABIN630439

This Rabbit Polyclonal antibody specifically detects NEU1 in WB and IHC. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for NEU1 antibody (ABIN630439)

Target: NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEU1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-NEU1 Antibody

Purification: Purified

Immunogen: NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEU1 Blocking Peptide, (ABIN5614961), is also available for use as a blocking control in assays to test for specificity of this NEU1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEU1

Target: NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))

Alternative Name: NEU1

Background: NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome