NPTN antibody (Middle Region)
-
- Target See all NPTN Antibodies
- NPTN (Neuroplastin (NPTN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NPTN antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Neuroplastin antibody was raised against the middle region of NPTN
- Purification
- Purified
- Immunogen
- Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
- Top Product
- Discover our top product NPTN Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NPTN (Neuroplastin (NPTN))
- Alternative Name
- Neuroplastin (NPTN Products)
- Background
- Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Regulation of long-term Neuronal Synaptic Plasticity
-