NPTN antibody (Middle Region)

Catalog No. ABIN630447

This anti-NPTN antibody is a Rabbit Polyclonal antibody detecting NPTN in WB and IHC. Suitable for Human, Rat, Mouse and Dog.

Quick Overview for NPTN antibody (Middle Region) (ABIN630447)

Target: NPTN (Neuroplastin (NPTN))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPTN antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-NPTN Antibody

Binding Specificity: Middle Region

Specificity: Neuroplastin antibody was raised against the middle region of NPTN

Purification: Purified

Immunogen: Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neuroplastin Blocking Peptide, (ABIN5614974), is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NPTN

Target: NPTN (Neuroplastin (NPTN))

Alternative Name: Neuroplastin

Background: Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Regulation of long-term Neuronal Synaptic Plasticity