PIGV antibody (N-Term)

Catalog No. ABIN630452

The Rabbit Polyclonal anti-PIGV antibody is suitable to detect PIGV in samples from Human, Dog, Mouse and Rat. It has been validated for WB and IHC.

Quick Overview for PIGV antibody (N-Term) (ABIN630452)

Target: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Reactivity: Human, Dog, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIGV antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PIGV Antibody

Binding Specificity: N-Term

Specificity: PIGV antibody was raised against the N terminal of PIGV

Purification: Purified

Immunogen: PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGV Blocking Peptide, (ABIN938497), is also available for use as a blocking control in assays to test for specificity of this PIGV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIGV

Target: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Alternative Name: PIGV

Background: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Inositol Metabolic Process