Butyrylcholinesterase antibody (N-Term)

Catalog No. ABIN630462

This anti-Butyrylcholinesterase antibody is a Rabbit Polyclonal antibody detecting Butyrylcholinesterase in WB and IHC. Suitable for Human, Dog and Mouse.

Quick Overview for Butyrylcholinesterase antibody (N-Term) (ABIN630462)

Target: Butyrylcholinesterase (BCHE)

Reactivity: Human, Dog, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Butyrylcholinesterase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Butyrylcholinesterase Antibody

Binding Specificity: N-Term

Specificity: BCHE antibody was raised against the N terminal of BCHE

Purification: Purified

Immunogen: BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCHE Blocking Peptide, (ABIN5612293), is also available for use as a blocking control in assays to test for specificity of this BCHE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Butyrylcholinesterase

Target: Butyrylcholinesterase (BCHE)

Alternative Name: BCHE

Background: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism