TM9SF1 antibody (Middle Region)
-
- Target See all TM9SF1 Antibodies
- TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TM9SF1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- TM9 SF1 antibody was raised against the middle region of TM9 F1
- Purification
- Purified
- Immunogen
- TM9 SF1 antibody was raised using the middle region of TM9 F1 corresponding to a region with amino acids THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV
- Top Product
- Discover our top product TM9SF1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TM9SF1 Blocking Peptide, catalog no. 33R-9110, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))
- Alternative Name
- TM9SF1 (TM9SF1 Products)
- Synonyms
- TM9SF1 antibody, fa03b09 antibody, wu:fa03b09 antibody, zgc:100810 antibody, HMP70 antibody, MP70 antibody, 1200014D02Rik antibody, AI893436 antibody, transmembrane 9 superfamily member 1 antibody, transmembrane 9 superfamily member 1 L homeolog antibody, TM9SF1 antibody, tm9sf1 antibody, tm9sf1.L antibody, Tm9sf1 antibody
- Background
- TM9SF1 may function as channel, small molecule transporter or receptor.
- Molecular Weight
- 67 kDa (MW of target protein)
-