TMEM178 antibody (Middle Region)

Catalog No. ABIN630480

Product Details anti-TMEM178 Antibody

Target: TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM178 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MGC33926 antibody was raised against the middle region of Mgc33926

Purification: Purified

Immunogen: MGC33926 antibody was raised using the middle region of Mgc33926 corresponding to a region with amino acids RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC33926 Blocking Peptide, catalog no. 33R-8049, is also available for use as a blocking control in assays to test for specificity of this MGC33926 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC33926 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM178

Target: TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))

Abstract: TMEM178A Products

Synonyms: TMEM178 antibody, 2810417M05Rik antibody, Tmem178a antibody, Tmem178 antibody, tmem178 antibody, tmem178.1 antibody, tmem178a antibody, zgc:153181 antibody, transmembrane protein 178A antibody, transmembrane protein 178 antibody, transmembrane protein 178A S homeolog antibody, TMEM178A antibody, Tmem178 antibody, Tmem178a antibody, tmem178a.S antibody, tmem178 antibody

Background: The function of MGC33926 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 33 kDa (MW of target protein)