Retinoid X Receptor alpha antibody (N-Term)

Catalog No. ABIN630495

This anti-Retinoid X Receptor alpha antibody is a Rabbit Polyclonal antibody detecting Retinoid X Receptor alpha in WB. Suitable for Human.

Quick Overview for Retinoid X Receptor alpha antibody (N-Term) (ABIN630495)

Target: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoid X Receptor alpha antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Retinoid X Receptor alpha Antibody

Binding Specificity: N-Term

Specificity: RXRA antibody was raised against the N terminal of RXRA

Purification: Affinity purified

Immunogen: RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RXRA Blocking Peptide, (ABIN937582), is also available for use as a blocking control in assays to test for specificity of this RXRA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoid X Receptor alpha

Target: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Alternative Name: RXRA

Background: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C