HBS1L antibody

Catalog No. ABIN630516

Product Details anti-HBS1L Antibody

Target: HBS1L (HBS1-Like (HBS1L))

Reactivity: Hepatitis B Virus (HBV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HBS1L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HBS1L

Target: HBS1L (HBS1-Like (HBS1L))

Abstract: HBS1L Products

Synonyms: EF-1a antibody, ERFS antibody, HBS1 antibody, HSPC276 antibody, 2810035F15Rik antibody, AI326327 antibody, eRFS antibody, wu:fc23c07 antibody, zgc:55400 antibody, EFL1-alpha antibody, chunp6927 antibody, eef1a antibody, ef1a antibody, ik:tdsubc_2a3 antibody, ik:tdsubc_2b3 antibody, tdsubc_2a3 antibody, wu:fa91c07 antibody, wu:fa94b03 antibody, wu:fi13b09 antibody, xx:tdsubc_2a3 antibody, xx:tdsubc_2b3 antibody, Hbs1l antibody, HBS1 like translational GTPase antibody, Hbs1-like (S. cerevisiae) antibody, HBS1-like translational GTPase antibody, elongation factor 1 alpha like protein antibody, HBS1-like (S. cerevisiae) antibody, eukaryotic translation elongation factor 1 alpha 1, like 1 antibody, HBS1 like translational GTPase L homeolog antibody, HBS1-like protein antibody, HBS1L antibody, Hbs1l antibody, hbs1l antibody, SJAG_02601 antibody, eef1a1l1 antibody, hbs1l.L antibody, LOC101787962 antibody

Target Type: Viral Protein

Background: HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Molecular Weight: 22 kDa (MW of target protein)