DLC1 antibody (C-Term)

Catalog No. ABIN630519

This anti-DLC1 antibody is a Rabbit Polyclonal antibody detecting DLC1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for DLC1 antibody (C-Term) (ABIN630519)

Target: DLC1 (Deleted in Liver Cancer 1 (DLC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLC1 Antibody

Binding Specificity: C-Term

Specificity: DLC1 antibody was raised against the C terminal of DLC1

Purification: Affinity purified

Immunogen: DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLC1 Blocking Peptide, (ABIN5613215), is also available for use as a blocking control in assays to test for specificity of this DLC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLC1

Target: DLC1 (Deleted in Liver Cancer 1 (DLC1))

Alternative Name: DLC1

Background: This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Tube Formation, Positive Regulation of Endopeptidase Activity