ZNF33A antibody (Middle Region)

Catalog No. ABIN630524

Product Details anti-ZNF33A Antibody

Target: ZNF33A (Zinc Finger Protein 33A (ZNF33A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF33A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZNF33 A antibody was raised against the middle region of ZNF33

Purification: Affinity purified

Immunogen: ZNF33 A antibody was raised using the middle region of ZNF33 corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZNF33A Blocking Peptide, catalog no. 33R-5320, is also available for use as a blocking control in assays to test for specificity of this ZNF33A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZNF33A

Target: ZNF33A (Zinc Finger Protein 33A (ZNF33A))

Alternative Name: ZNF33A (ZNF33A Products)

Synonyms: KOX2 antibody, KOX31 antibody, KOX5 antibody, NF11A antibody, ZNF11 antibody, ZNF11A antibody, ZNF33 antibody, ZZAPK antibody, zinc finger protein 33A antibody, ZNF33A antibody

Background: ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.

Molecular Weight: 80 kDa (MW of target protein)