CCDC46 antibody (C-Term)

Catalog No. ABIN630527

The Rabbit Polyclonal anti-CCDC46 antibody has been validated for WB. It is suitable to detect CCDC46 in samples from Human.

Quick Overview for CCDC46 antibody (C-Term) (ABIN630527)

Target: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC46 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC46 Antibody

Binding Specificity: C-Term

Specificity: CCDC46 antibody was raised against the C terminal of CCDC46

Purification: Affinity purified

Immunogen: CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC46 Blocking Peptide, (ABIN939328), is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC46

Target: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Alternative Name: CCDC46

Background: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome