Achaete-scute complex protein T5 (AC) (N-Term) antibody

Catalog No. ABIN630551

Product Details

Target: Achaete-scute complex protein T5 (AC)

Binding Specificity: N-Term

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: AC antibody was raised against the N terminal Of Ac

Purification: Affinity purified

Immunogen: AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AC Blocking Peptide, catalog no. 33R-3003, is also available for use as a blocking control in assays to test for specificity of this AC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Achaete-scute complex protein T5 (AC)

Abstract: AC Products

Synonyms: AC antibody, ACDase antibody, ASAH antibody, PHP antibody, PHP32 antibody, SMAPME antibody, N-acylsphingosine amidohydrolase 1 antibody, ASAH1 antibody

Background: The function of AC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 23 kDa (MW of target protein)