CBR1 antibody (Middle Region)

Catalog No. ABIN630569

The Rabbit Polyclonal anti-CBR1 antibody has been validated for WB. It is suitable to detect CBR1 in samples from Human.

Quick Overview for CBR1 antibody (Middle Region) (ABIN630569)

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CBR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CBR1 Antibody

Binding Specificity: Middle Region

Specificity: Carbonyl Reductase 1 antibody was raised against the middle region of CBR1

Purification: Affinity purified

Immunogen: Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonyl Reductase 1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CBR1

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Alternative Name: Carbonyl Reductase 1

Background: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.

Molecular Weight: 30 kDa (MW of target protein)