CBR1 antibody (Middle Region)
-
- Target See all CBR1 Antibodies
- CBR1 (Carbonyl Reductase 1 (CBR1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CBR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carbonyl Reductase 1 antibody was raised against the middle region of CBR1
- Purification
- Affinity purified
- Immunogen
- Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
- Top Product
- Discover our top product CBR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-1155, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBR1 (Carbonyl Reductase 1 (CBR1))
- Alternative Name
- Carbonyl Reductase 1 (CBR1 Products)
- Synonyms
- LOC100222525 antibody, MGC131152 antibody, CBR antibody, SDR21C1 antibody, hCBR1 antibody, 9-KPR antibody, AW261796 antibody, CR antibody, Cbr antibody, carbonyl reductase 1 antibody, carbonyl reductase [NADPH] 1 antibody, carbonyl reductase 1 S homeolog antibody, carbonyl reductase antibody, cbr1 antibody, CBR1 antibody, LOC100222525 antibody, cbr1.S antibody, Smp_033530.3 antibody, LOC610164 antibody, Cbr1 antibody
- Background
- Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
- Molecular Weight
- 30 kDa (MW of target protein)
-