CBR1 antibody (Middle Region)

Catalog No. ABIN630569

Product Details anti-CBR1 Antibody

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CBR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Carbonyl Reductase 1 antibody was raised against the middle region of CBR1

Purification: Affinity purified

Immunogen: Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-1155, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CBR1

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Alternative Name: Carbonyl Reductase 1 (CBR1 Products)

Synonyms: LOC100222525 antibody, MGC131152 antibody, CBR antibody, SDR21C1 antibody, hCBR1 antibody, 9-KPR antibody, AW261796 antibody, CR antibody, Cbr antibody, carbonyl reductase 1 antibody, carbonyl reductase [NADPH] 1 antibody, carbonyl reductase 1 S homeolog antibody, carbonyl reductase antibody, cbr1 antibody, CBR1 antibody, LOC100222525 antibody, cbr1.S antibody, Smp_033530.3 antibody, LOC610164 antibody, Cbr1 antibody

Background: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.

Molecular Weight: 30 kDa (MW of target protein)