DONSON antibody (Middle Region)

Catalog No. ABIN630570

Product Details anti-DONSON Antibody

Target: DONSON (Downstream Neighbor of SON (DONSON))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DONSON antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DONSON antibody was raised against the middle region of DONSON

Purification: Affinity purified

Immunogen: DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DONSON Blocking Peptide, catalog no. 33R-2048, is also available for use as a blocking control in assays to test for specificity of this DONSON antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DONSON antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DONSON

Target: DONSON (Downstream Neighbor of SON (DONSON))

Alternative Name: DONSON (DONSON Products)

Synonyms: B17 antibody, C21orf60 antibody, C2TA antibody, 1110025J21Rik antibody, AI845729 antibody, ORF60 antibody, MGC76196 antibody, downstream neighbor of SON antibody, downstream neighbor of Son antibody, protein downstream neighbor of Son antibody, downstream neighbor of SON L homeolog antibody, DONSON antibody, CpipJ_CPIJ018445 antibody, Donson antibody, donson antibody, LOC478407 antibody, donson.L antibody

Background: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Molecular Weight: 63 kDa (MW of target protein)