GUK1 antibody (Middle Region)

Catalog No. ABIN630582

Product Details anti-GUK1 Antibody

Target: GUK1 (Guanylate Kinase 1 (GUK1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GUK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GUK1 antibody was raised against the middle region of GUK1

Purification: Affinity purified

Immunogen: GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GUK1 Blocking Peptide, catalog no. 33R-3939, is also available for use as a blocking control in assays to test for specificity of this GUK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GUK1

Target: GUK1 (Guanylate Kinase 1 (GUK1))

Alternative Name: GUK1 (GUK1 Products)

Synonyms: GMK antibody, AA409738 antibody, AL033299 antibody, AL033300 antibody, AV026611 antibody, Gmk antibody, Guk-1 antibody, guk1 antibody, zgc:73128 antibody, zgc:73217 antibody, gmk antibody, GUK1 antibody, AGK1 antibody, T11A7.23 antibody, guanylate kinase 1 antibody, DDBDRAFT_0215291 antibody, DDBDRAFT_0230100 antibody, DDB_0215291 antibody, DDB_0230100 antibody, sb:cb295 antibody, zgc:86776 antibody, guanylate kinase 1 antibody, guanylate kinase (GUK1) antibody, guanylate kinase antibody, guanylate kinase 1b antibody, guanylate kinase 1 L homeolog antibody, guanylate kinase 1a antibody, GUK1 antibody, Guk1 antibody, guk1b antibody, guk1 antibody, guk1.L antibody, GK-1 antibody, gmk antibody, gmkA antibody, Mrub_2093 antibody, Arnit_0783 antibody, Ndas_3097 antibody, Mesil_1319 antibody, Slip_0854 antibody, Olsu_0986 antibody, Acear_1451 antibody, AOR_1_2886174 antibody, guk1a antibody

Background: GUK1 is essential for recycling GMP and indirectly, cGMP.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process