Tropomyosin antibody

Catalog No. ABIN630583

Product Details anti-Tropomyosin Antibody

Target: Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tropomyosin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tropomyosin 1 Blocking Peptide, catalog no. 33R-5082, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tropomyosin

Target: Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))

Alternative Name: Tropomyosin 1 (TPM1 Products)

Synonyms: alpha-fTM antibody, Tm7 antibody, tpm1 antibody, MGC84844 antibody, AA986836 antibody, AI854628 antibody, TM2 antibody, Tm3 antibody, Tmpa antibody, Tpm-1 antibody, alpha-TM antibody, Alpha-tm antibody, Tma2 antibody, Tmsa antibody, TPM1 antibody, fb37a09 antibody, tm antibody, wu:fb37a09 antibody, CH1 antibody, alpha-tm antibody, alpha-tropomyosin antibody, C15orf13 antibody, CMD1Y antibody, CMH3 antibody, HTM-alpha antibody, TMSA antibody, TPMA antibody, Tm1 antibody, zgc:171719 antibody, zgc:55951 antibody, zgc:77009 antibody, tropomyosin 1 (alpha) antibody, tropomyosin antibody, tropomyosin 1 antibody, tropomyosin 1, alpha antibody, alpha-tropomyosin antibody, tropomyosin 1 L homeolog antibody, TPM1 antibody, tm7 antibody, Tpm1 antibody, tpma antibody, tpm1.L antibody, Smp_044010.2 antibody, LOC732984 antibody, tpm1 antibody

Background: TPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization