TRIM54 antibody (N-Term)

Catalog No. ABIN630592

This Rabbit Polyclonal antibody specifically detects TRIM54 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TRIM54 antibody (N-Term) (ABIN630592)

Target: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM54 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRIM54 Antibody

Binding Specificity: N-Term

Specificity: TRIM54 antibody was raised against the N terminal of TRIM54

Purification: Affinity purified

Immunogen: TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM54 Blocking Peptide, (ABIN5616785), is also available for use as a blocking control in assays to test for specificity of this TRIM54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM54

Target: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Alternative Name: TRIM54

Background: TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.

Molecular Weight: 45 kDa (MW of target protein)