MBD1 antibody (Middle Region)
-
- Target See all MBD1 Antibodies
- MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MBD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MBD1 antibody was raised against the middle region of MBD1
- Purification
- Affinity purified
- Immunogen
- MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ
- Top Product
- Discover our top product MBD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MBD1 Blocking Peptide, catalog no. 33R-1727, is also available for use as a blocking control in assays to test for specificity of this MBD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))
- Alternative Name
- MBD1 (MBD1 Products)
- Synonyms
- CXXC3 antibody, PCM1 antibody, RFT antibody, Cxxc3 antibody, CCDC11 antibody, methyl-CpG binding domain protein 1 antibody, MBD1 antibody, Mbd1 antibody
- Background
- MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus.
- Molecular Weight
- 65 kDa (MW of target protein)
-