HNF4A antibody (Middle Region)

Catalog No. ABIN630607

This Rabbit Polyclonal antibody specifically detects HNF4A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for HNF4A antibody (Middle Region) (ABIN630607)

Target: HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNF4A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HNF4A Antibody

Binding Specificity: Middle Region

Specificity: HNF4 A antibody was raised against the middle region of HNF4

Purification: Affinity purified

Immunogen: HNF4 A antibody was raised using the middle region of HNF4 corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNF4A Blocking Peptide, (ABIN5614035), is also available for use as a blocking control in assays to test for specificity of this HNF4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNF4A

Target: HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))

Alternative Name: HNF4A

Background: The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: AMPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, Cell-Cell Junction Organization, Regulation of Carbohydrate Metabolic Process