POLR1D antibody

Catalog No. ABIN630612

The Rabbit Polyclonal anti-POLR1D antibody (ABIN630612) specifically detects POLR1D in WB. The antibody is reactive with Human samples.

Quick Overview for POLR1D antibody (ABIN630612)

Target: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR1D antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POLR1D Antibody

Purification: Affinity purified

Immunogen: POLR1 D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR1D Blocking Peptide, (ABIN5615462), is also available for use as a blocking control in assays to test for specificity of this POLR1D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR1D

Target: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Alternative Name: POLR1D

Background: POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.

Molecular Weight: 15 kDa (MW of target protein)