EGR1 antibody (Middle Region)

Catalog No. ABIN630613

This Rabbit Polyclonal antibody specifically detects EGR1 in WB. It exhibits reactivity toward Human.

Quick Overview for EGR1 antibody (Middle Region) (ABIN630613)

Target: EGR1 (Early Growth Response 1 (EGR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EGR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EGR1 Antibody

Binding Specificity: Middle Region

Specificity: EGR1 antibody was raised against the middle region of EGR1

Purification: Affinity purified

Immunogen: EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EGR1 Blocking Peptide, (ABIN5613319), is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EGR1

Target: EGR1 (Early Growth Response 1 (EGR1))

Alternative Name: EGR1

Background: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity