EGR1 antibody (Middle Region)

Catalog No. ABIN630613

Product Details anti-EGR1 Antibody

Target: EGR1 (Early Growth Response 1 (EGR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EGR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EGR1 antibody was raised against the middle region of EGR1

Purification: Affinity purified

Immunogen: EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EGR1 Blocking Peptide, catalog no. 33R-7362, is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EGR1

Target: EGR1 (Early Growth Response 1 (EGR1))

Alternative Name: EGR1 (EGR1 Products)

Synonyms: AT225 antibody, G0S30 antibody, KROX-24 antibody, NGFI-A antibody, TIS8 antibody, ZIF-268 antibody, ZNF225 antibody, A530045N19Rik antibody, ETR103 antibody, Egr-1 antibody, Krox-1 antibody, Krox-24 antibody, Krox24 antibody, NGF1-A antibody, NGFIA antibody, Zenk antibody, Zfp-6 antibody, Zif268 antibody, egr antibody, Ngf1 antibody, Ngfi antibody, zif-268 antibody, EGR1 antibody, EGR-1-A antibody, Xegr-1 antibody, at225 antibody, egr-1 antibody, egr1 antibody, g0s30 antibody, krox-24 antibody, ngfi-a antibody, tis8 antibody, znf225 antibody, krox24 antibody, wu:fj64b05 antibody, wu:fq25f01 antibody, EGR-1 antibody, zenk antibody, EGR-1-B antibody, egr1-a antibody, egr1-b antibody, early growth response 1 antibody, early growth response protein 1 (egr-1) antibody, early growth response 1 L homeolog antibody, early growth response 1 S homeolog antibody, EGR1 antibody, CNK00890 antibody, Egr1 antibody, egr1.L antibody, egr1 antibody, egr1.S antibody

Background: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity