Cnpase antibody (Middle Region)

Catalog No. ABIN630617

The Rabbit Polyclonal anti-Cnpase antibody is suitable to detect Cnpase in samples from Human. It has been validated for WB.

Quick Overview for Cnpase antibody (Middle Region) (ABIN630617)

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cnpase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cnpase Antibody

Binding Specificity: Middle Region

Specificity: CNP antibody was raised against the middle region of CNP

Purification: Affinity purified

Immunogen: CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNP Blocking Peptide, (ABIN5612942), is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Alternative Name: CNP

Background: CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.

Molecular Weight: 47 kDa (MW of target protein)