Cnpase antibody (Middle Region)

Catalog No. ABIN630617

Product Details anti-Cnpase Antibody

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cnpase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CNP antibody was raised against the middle region of CNP

Purification: Affinity purified

Immunogen: CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNP Blocking Peptide, catalog no. 33R-5574, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Alternative Name: CNP (CNP Products)

Synonyms: CNP1 antibody, CNPase antibody, Cnp-1 antibody, Cnp1 antibody, CNPF antibody, CNPI antibody, CNPII antibody, CNP antibody, DKFZp469F1421 antibody, cnpl antibody, fd21d08 antibody, fi37a10 antibody, rich antibody, sb:cb662 antibody, si:ch73-158e11.4 antibody, wu:fd21d08 antibody, wu:fd44a05 antibody, wu:fi35d08 antibody, wu:fi37a10 antibody, cnp antibody, 2',3'-cyclic nucleotide 3' phosphodiesterase antibody, CNP antibody, Cnp antibody, cnp antibody, cnp.L antibody

Background: CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.

Molecular Weight: 47 kDa (MW of target protein)